Anti CLNS1A pAb (ATL-HPA031707)
Atlas Antibodies
- SKU:
- ATL-HPA031707-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CLNS1A
Alternative Gene Name: CLCI, ICln
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025439: 96%, ENSRNOG00000012788: 96%
Entrez Gene ID: 1207
Uniprot ID: P54105
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YTYEEGLSHLTAEGQATLERLEGMLSQSVSSQYNMAGVRTEDSIRDYEDGMEVDTTPTVAGQFEDADVDH |
Gene Sequence | YTYEEGLSHLTAEGQATLERLEGMLSQSVSSQYNMAGVRTEDSIRDYEDGMEVDTTPTVAGQFEDADVDH |
Gene ID - Mouse | ENSMUSG00000025439 |
Gene ID - Rat | ENSRNOG00000012788 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CLNS1A pAb (ATL-HPA031707) | |
Datasheet | Anti CLNS1A pAb (ATL-HPA031707) Datasheet (External Link) |
Vendor Page | Anti CLNS1A pAb (ATL-HPA031707) at Atlas Antibodies |
Documents & Links for Anti CLNS1A pAb (ATL-HPA031707) | |
Datasheet | Anti CLNS1A pAb (ATL-HPA031707) Datasheet (External Link) |
Vendor Page | Anti CLNS1A pAb (ATL-HPA031707) |