Anti CLNK pAb (ATL-HPA035671)

Atlas Antibodies

Catalog No.:
ATL-HPA035671-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: cytokine-dependent hematopoietic cell linker
Gene Name: CLNK
Alternative Gene Name: MIST
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039315: 59%, ENSRNOG00000051169: 56%
Entrez Gene ID: 116449
Uniprot ID: Q7Z7G1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PIKESEYADTHYFKVAMDTPLPLDTRTSISIGQPTWNTQTRLERVDKPISKDVRSQNIKGDASVRKNKIPLPPPRPLITLPKKYQPL
Gene Sequence PIKESEYADTHYFKVAMDTPLPLDTRTSISIGQPTWNTQTRLERVDKPISKDVRSQNIKGDASVRKNKIPLPPPRPLITLPKKYQPL
Gene ID - Mouse ENSMUSG00000039315
Gene ID - Rat ENSRNOG00000051169
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CLNK pAb (ATL-HPA035671)
Datasheet Anti CLNK pAb (ATL-HPA035671) Datasheet (External Link)
Vendor Page Anti CLNK pAb (ATL-HPA035671) at Atlas Antibodies

Documents & Links for Anti CLNK pAb (ATL-HPA035671)
Datasheet Anti CLNK pAb (ATL-HPA035671) Datasheet (External Link)
Vendor Page Anti CLNK pAb (ATL-HPA035671)