Anti CLN6 pAb (ATL-HPA074162)

Atlas Antibodies

Catalog No.:
ATL-HPA074162-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ceroid-lipofuscinosis, neuronal 6, late infantile, variant
Gene Name: CLN6
Alternative Gene Name: FLJ20561, HsT18960, nclf
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032245: 89%, ENSRNOG00000007164: 89%
Entrez Gene ID: 54982
Uniprot ID: Q9NWW5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LVFPLEWFPLNKPSVGDYFHMAYNVITPFLLLKLIERSPRTLPRSIT
Gene Sequence LVFPLEWFPLNKPSVGDYFHMAYNVITPFLLLKLIERSPRTLPRSIT
Gene ID - Mouse ENSMUSG00000032245
Gene ID - Rat ENSRNOG00000007164
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CLN6 pAb (ATL-HPA074162)
Datasheet Anti CLN6 pAb (ATL-HPA074162) Datasheet (External Link)
Vendor Page Anti CLN6 pAb (ATL-HPA074162) at Atlas Antibodies

Documents & Links for Anti CLN6 pAb (ATL-HPA074162)
Datasheet Anti CLN6 pAb (ATL-HPA074162) Datasheet (External Link)
Vendor Page Anti CLN6 pAb (ATL-HPA074162)