Anti CLN6 pAb (ATL-HPA066759)
Atlas Antibodies
- Catalog No.:
- ATL-HPA066759-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CLN6
Alternative Gene Name: FLJ20561, HsT18960, nclf
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032245: 100%, ENSRNOG00000007164: 100%
Entrez Gene ID: 54982
Uniprot ID: Q9NWW5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VGDSVNHRLLFSGYQHHLSVRENPIIKNLKPETLIDSFELLYYYDEYL |
Gene Sequence | VGDSVNHRLLFSGYQHHLSVRENPIIKNLKPETLIDSFELLYYYDEYL |
Gene ID - Mouse | ENSMUSG00000032245 |
Gene ID - Rat | ENSRNOG00000007164 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CLN6 pAb (ATL-HPA066759) | |
Datasheet | Anti CLN6 pAb (ATL-HPA066759) Datasheet (External Link) |
Vendor Page | Anti CLN6 pAb (ATL-HPA066759) at Atlas Antibodies |
Documents & Links for Anti CLN6 pAb (ATL-HPA066759) | |
Datasheet | Anti CLN6 pAb (ATL-HPA066759) Datasheet (External Link) |
Vendor Page | Anti CLN6 pAb (ATL-HPA066759) |