Anti CLN6 pAb (ATL-HPA066759)

Atlas Antibodies

SKU: ATL-HPA066759-25

• 
• 

Protein Description: CLN6, transmembrane ER protein
Gene Name: CLN6
Alternative Gene Name: FLJ20561, HsT18960, nclf
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032245: 100%, ENSRNOG00000007164: 100%
Entrez Gene ID: 54982
Uniprot ID: Q9NWW5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VGDSVNHRLLFSGYQHHLSVRENPIIKNLKPETLIDSFELLYYYDEYL
• Gene Sequence: VGDSVNHRLLFSGYQHHLSVRENPIIKNLKPETLIDSFELLYYYDEYL
• Gene ID - Mouse: ENSMUSG00000032245
• Gene ID - Rat: ENSRNOG00000007164
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.