Anti CLN5 pAb (ATL-HPA041788 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041788-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CLN5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022125: 83%, ENSRNOG00000055439: 85%
Entrez Gene ID: 1203
Uniprot ID: O75503
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TLTGKNYTMEWYELFQLGNCTFPHLRPEMDAPFWCNQGAACFFEGIDDVHWKENGTLVQVATISGNMFNQMAKWVKQDNETGIYYETWNVKASPEK |
| Gene Sequence | TLTGKNYTMEWYELFQLGNCTFPHLRPEMDAPFWCNQGAACFFEGIDDVHWKENGTLVQVATISGNMFNQMAKWVKQDNETGIYYETWNVKASPEK |
| Gene ID - Mouse | ENSMUSG00000022125 |
| Gene ID - Rat | ENSRNOG00000055439 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CLN5 pAb (ATL-HPA041788 w/enhanced validation) | |
| Datasheet | Anti CLN5 pAb (ATL-HPA041788 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CLN5 pAb (ATL-HPA041788 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CLN5 pAb (ATL-HPA041788 w/enhanced validation) | |
| Datasheet | Anti CLN5 pAb (ATL-HPA041788 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CLN5 pAb (ATL-HPA041788 w/enhanced validation) |