Anti CLN3 pAb (ATL-HPA063280)
Atlas Antibodies
- Catalog No.:
- ATL-HPA063280-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CLN3
Alternative Gene Name: BTS, JNCL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030720: 78%, ENSRNOG00000019103: 73%
Entrez Gene ID: 1201
Uniprot ID: Q13286
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EEEAESAARQPLIRTEAPESKPGSSSSLSLRERWTVF |
Gene Sequence | EEEAESAARQPLIRTEAPESKPGSSSSLSLRERWTVF |
Gene ID - Mouse | ENSMUSG00000030720 |
Gene ID - Rat | ENSRNOG00000019103 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CLN3 pAb (ATL-HPA063280) | |
Datasheet | Anti CLN3 pAb (ATL-HPA063280) Datasheet (External Link) |
Vendor Page | Anti CLN3 pAb (ATL-HPA063280) at Atlas Antibodies |
Documents & Links for Anti CLN3 pAb (ATL-HPA063280) | |
Datasheet | Anti CLN3 pAb (ATL-HPA063280) Datasheet (External Link) |
Vendor Page | Anti CLN3 pAb (ATL-HPA063280) |