Anti CLK4 pAb (ATL-HPA043746)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043746-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CLK4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020385: 91%, ENSRNOG00000025768: 52%
Entrez Gene ID: 57396
Uniprot ID: Q9HAZ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EYRNDYCEGYVPRHYHRDIESGYRIHCSKSSVRSRRSSPKRKRNRHCSSHQSRSKSHR |
| Gene Sequence | EYRNDYCEGYVPRHYHRDIESGYRIHCSKSSVRSRRSSPKRKRNRHCSSHQSRSKSHR |
| Gene ID - Mouse | ENSMUSG00000020385 |
| Gene ID - Rat | ENSRNOG00000025768 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CLK4 pAb (ATL-HPA043746) | |
| Datasheet | Anti CLK4 pAb (ATL-HPA043746) Datasheet (External Link) |
| Vendor Page | Anti CLK4 pAb (ATL-HPA043746) at Atlas Antibodies |
| Documents & Links for Anti CLK4 pAb (ATL-HPA043746) | |
| Datasheet | Anti CLK4 pAb (ATL-HPA043746) Datasheet (External Link) |
| Vendor Page | Anti CLK4 pAb (ATL-HPA043746) |