Anti CLK4 pAb (ATL-HPA043746)

Atlas Antibodies

Catalog No.:
ATL-HPA043746-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: CDC-like kinase 4
Gene Name: CLK4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020385: 91%, ENSRNOG00000025768: 52%
Entrez Gene ID: 57396
Uniprot ID: Q9HAZ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EYRNDYCEGYVPRHYHRDIESGYRIHCSKSSVRSRRSSPKRKRNRHCSSHQSRSKSHR
Gene Sequence EYRNDYCEGYVPRHYHRDIESGYRIHCSKSSVRSRRSSPKRKRNRHCSSHQSRSKSHR
Gene ID - Mouse ENSMUSG00000020385
Gene ID - Rat ENSRNOG00000025768
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CLK4 pAb (ATL-HPA043746)
Datasheet Anti CLK4 pAb (ATL-HPA043746) Datasheet (External Link)
Vendor Page Anti CLK4 pAb (ATL-HPA043746) at Atlas Antibodies

Documents & Links for Anti CLK4 pAb (ATL-HPA043746)
Datasheet Anti CLK4 pAb (ATL-HPA043746) Datasheet (External Link)
Vendor Page Anti CLK4 pAb (ATL-HPA043746)