Anti CLK3 pAb (ATL-HPA046817)

Atlas Antibodies

Catalog No.:
ATL-HPA046817-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: CDC-like kinase 3
Gene Name: CLK3
Alternative Gene Name: clk3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032316: 98%, ENSRNOG00000030126: 100%
Entrez Gene ID: 1198
Uniprot ID: P49761
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RHRRRSRERGPYRTRKHAHHCHKRRTRSCSSASSRSQQSSKRSSRSVEDDKE
Gene Sequence RHRRRSRERGPYRTRKHAHHCHKRRTRSCSSASSRSQQSSKRSSRSVEDDKE
Gene ID - Mouse ENSMUSG00000032316
Gene ID - Rat ENSRNOG00000030126
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CLK3 pAb (ATL-HPA046817)
Datasheet Anti CLK3 pAb (ATL-HPA046817) Datasheet (External Link)
Vendor Page Anti CLK3 pAb (ATL-HPA046817) at Atlas Antibodies

Documents & Links for Anti CLK3 pAb (ATL-HPA046817)
Datasheet Anti CLK3 pAb (ATL-HPA046817) Datasheet (External Link)
Vendor Page Anti CLK3 pAb (ATL-HPA046817)