Anti CLK3 pAb (ATL-HPA046817)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046817-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CLK3
Alternative Gene Name: clk3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032316: 98%, ENSRNOG00000030126: 100%
Entrez Gene ID: 1198
Uniprot ID: P49761
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RHRRRSRERGPYRTRKHAHHCHKRRTRSCSSASSRSQQSSKRSSRSVEDDKE |
| Gene Sequence | RHRRRSRERGPYRTRKHAHHCHKRRTRSCSSASSRSQQSSKRSSRSVEDDKE |
| Gene ID - Mouse | ENSMUSG00000032316 |
| Gene ID - Rat | ENSRNOG00000030126 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CLK3 pAb (ATL-HPA046817) | |
| Datasheet | Anti CLK3 pAb (ATL-HPA046817) Datasheet (External Link) |
| Vendor Page | Anti CLK3 pAb (ATL-HPA046817) at Atlas Antibodies |
| Documents & Links for Anti CLK3 pAb (ATL-HPA046817) | |
| Datasheet | Anti CLK3 pAb (ATL-HPA046817) Datasheet (External Link) |
| Vendor Page | Anti CLK3 pAb (ATL-HPA046817) |