Anti CLK2 pAb (ATL-HPA055366)

Atlas Antibodies

Catalog No.:
ATL-HPA055366-100
Shipping:
Calculated at Checkout
$593.00
Adding to cart… The item has been added
Protein Description: CDC-like kinase 2
Gene Name: CLK2
Alternative Gene Name: clk2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068917: 95%, ENSRNOG00000020500: 95%
Entrez Gene ID: 1196
Uniprot ID: P49760
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HPRRYHSSERGSRGSYREHYRSRKHKRRRSRSWSSSSDRTRRRRREDSYHVRSRSSYDDRSSDR
Gene Sequence HPRRYHSSERGSRGSYREHYRSRKHKRRRSRSWSSSSDRTRRRRREDSYHVRSRSSYDDRSSDR
Gene ID - Mouse ENSMUSG00000068917
Gene ID - Rat ENSRNOG00000020500
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CLK2 pAb (ATL-HPA055366)
Datasheet Anti CLK2 pAb (ATL-HPA055366) Datasheet (External Link)
Vendor Page Anti CLK2 pAb (ATL-HPA055366) at Atlas Antibodies

Documents & Links for Anti CLK2 pAb (ATL-HPA055366)
Datasheet Anti CLK2 pAb (ATL-HPA055366) Datasheet (External Link)
Vendor Page Anti CLK2 pAb (ATL-HPA055366)
Citations for Anti CLK2 pAb (ATL-HPA055366) – 3 Found
Tiek, Deanna M; Erdogdu, Beril; Razaghi, Roham; Jin, Lu; Sadowski, Norah; Alamillo-Ferrer, Carla; Hogg, J Robert; Haddad, Bassem R; Drewry, David H; Wells, Carrow I; Pickett, Julie E; Song, Xiao; Goenka, Anshika; Hu, Bo; Goldlust, Samuel A; Zuercher, William J; Pertea, Mihaela; Timp, Winston; Cheng, Shi-Yuan; Riggins, Rebecca B. Temozolomide-induced guanine mutations create exploitable vulnerabilities of guanine-rich DNA and RNA regions in drug-resistant gliomas. Science Advances. 2022;8(25):eabn3471.  PubMed
Park, Soon Young; Piao, Yuji; Thomas, Craig; Fuller, Gregory N; de Groot, John F. Cdc2-like kinase 2 is a key regulator of the cell cycle via FOXO3a/p27 in glioblastoma. Oncotarget. 2016;7(18):26793-805.  PubMed
Park, Soon Young; Mittal, Sandeep; Dong, Jianwen; Jeong, Kangjin; Martinez-Ledesma, Emmanuel; Piao, Yuji; Khan, Sabbir; Henry, Verlene; Verhaak, Roel Gw; Majd, Nazanin; Balasubramaniyan, Veerakumar; de Groot, John F. Depletion of CLK2 sensitizes glioma stem-like cells to PI3K/mTOR and FGFR inhibitors. American Journal Of Cancer Research. 10(11):3765-3783.  PubMed