Anti CLIC3 pAb (ATL-HPA005963 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA005963-25
  • Immunohistochemistry analysis in human placenta and liver tissues using HPA005963 antibody. Corresponding CLIC3 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line A-431 shows localization to nuclear bodies.
  • Western blot analysis in human cell lines MCF-7 and A-549 using Anti-CLIC3 antibody. Corresponding CLIC3 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: chloride intracellular channel 3
Gene Name: CLIC3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015093: 92%, ENSRNOG00000015184: 91%
Entrez Gene ID: 9022
Uniprot ID: O95833
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MVLLLKGVPFTLTTVDTRRSPDVLKDFAPGSQLPILLYDSDAKTDTLQIEDFLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQ
Gene Sequence MVLLLKGVPFTLTTVDTRRSPDVLKDFAPGSQLPILLYDSDAKTDTLQIEDFLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQ
Gene ID - Mouse ENSMUSG00000015093
Gene ID - Rat ENSRNOG00000015184
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CLIC3 pAb (ATL-HPA005963 w/enhanced validation)
Datasheet Anti CLIC3 pAb (ATL-HPA005963 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CLIC3 pAb (ATL-HPA005963 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CLIC3 pAb (ATL-HPA005963 w/enhanced validation)
Datasheet Anti CLIC3 pAb (ATL-HPA005963 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CLIC3 pAb (ATL-HPA005963 w/enhanced validation)