Anti CLHC1 pAb (ATL-HPA053557)

Atlas Antibodies

Catalog No.:
ATL-HPA053557-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: clathrin heavy chain linker domain containing 1
Gene Name: CLHC1
Alternative Gene Name: C2orf63, FLJ31438
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020461: 78%, ENSRNOG00000004456: 76%
Entrez Gene ID: 130162
Uniprot ID: Q8NHS4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EIMLHYIERFNELISLGEYEKAACYAANSPRRILRNIGTMNTFKAVGKIRGKPLPLLLFFEALFITSHAFPCPVDAALTLEGIKCGLSEKRLDLVTNWVTQE
Gene Sequence EIMLHYIERFNELISLGEYEKAACYAANSPRRILRNIGTMNTFKAVGKIRGKPLPLLLFFEALFITSHAFPCPVDAALTLEGIKCGLSEKRLDLVTNWVTQE
Gene ID - Mouse ENSMUSG00000020461
Gene ID - Rat ENSRNOG00000004456
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CLHC1 pAb (ATL-HPA053557)
Datasheet Anti CLHC1 pAb (ATL-HPA053557) Datasheet (External Link)
Vendor Page Anti CLHC1 pAb (ATL-HPA053557) at Atlas Antibodies

Documents & Links for Anti CLHC1 pAb (ATL-HPA053557)
Datasheet Anti CLHC1 pAb (ATL-HPA053557) Datasheet (External Link)
Vendor Page Anti CLHC1 pAb (ATL-HPA053557)