Anti CLHC1 pAb (ATL-HPA053557)

Atlas Antibodies

SKU: ATL-HPA053557-25

• 

Protein Description: clathrin heavy chain linker domain containing 1
Gene Name: CLHC1
Alternative Gene Name: C2orf63, FLJ31438
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020461: 78%, ENSRNOG00000004456: 76%
Entrez Gene ID: 130162
Uniprot ID: Q8NHS4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EIMLHYIERFNELISLGEYEKAACYAANSPRRILRNIGTMNTFKAVGKIRGKPLPLLLFFEALFITSHAFPCPVDAALTLEGIKCGLSEKRLDLVTNWVTQE
• Gene Sequence: EIMLHYIERFNELISLGEYEKAACYAANSPRRILRNIGTMNTFKAVGKIRGKPLPLLLFFEALFITSHAFPCPVDAALTLEGIKCGLSEKRLDLVTNWVTQE
• Gene ID - Mouse: ENSMUSG00000020461
• Gene ID - Rat: ENSRNOG00000004456
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.