Anti CLEC5A pAb (ATL-HPA054137)

Atlas Antibodies

Catalog No.:
ATL-HPA054137-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: C-type lectin domain family 5 member A
Gene Name: CLEC5A
Alternative Gene Name: CLECSF5, MDL-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029915: 62%, ENSRNOG00000026306: 66%
Entrez Gene ID: 23601
Uniprot ID: Q9NY25
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PSPNGFITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQD
Gene Sequence PSPNGFITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQD
Gene ID - Mouse ENSMUSG00000029915
Gene ID - Rat ENSRNOG00000026306
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CLEC5A pAb (ATL-HPA054137)
Datasheet Anti CLEC5A pAb (ATL-HPA054137) Datasheet (External Link)
Vendor Page Anti CLEC5A pAb (ATL-HPA054137) at Atlas Antibodies

Documents & Links for Anti CLEC5A pAb (ATL-HPA054137)
Datasheet Anti CLEC5A pAb (ATL-HPA054137) Datasheet (External Link)
Vendor Page Anti CLEC5A pAb (ATL-HPA054137)