Anti CLEC3B pAb (ATL-HPA034794)
Atlas Antibodies
- Catalog No.:
- ATL-HPA034794-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CLEC3B
Alternative Gene Name: TN, TNA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025784: 82%, ENSRNOG00000004540: 83%
Entrez Gene ID: 7123
Uniprot ID: P05452
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGI |
Gene Sequence | TGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGI |
Gene ID - Mouse | ENSMUSG00000025784 |
Gene ID - Rat | ENSRNOG00000004540 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CLEC3B pAb (ATL-HPA034794) | |
Datasheet | Anti CLEC3B pAb (ATL-HPA034794) Datasheet (External Link) |
Vendor Page | Anti CLEC3B pAb (ATL-HPA034794) at Atlas Antibodies |
Documents & Links for Anti CLEC3B pAb (ATL-HPA034794) | |
Datasheet | Anti CLEC3B pAb (ATL-HPA034794) Datasheet (External Link) |
Vendor Page | Anti CLEC3B pAb (ATL-HPA034794) |
Citations for Anti CLEC3B pAb (ATL-HPA034794) – 1 Found |
Dodig-Crnković, Tea; Hong, Mun-Gwan; Thomas, Cecilia Engel; Häussler, Ragna S; Bendes, Annika; Dale, Matilda; Edfors, Fredrik; Forsström, Björn; Magnusson, Patrik K E; Schuppe-Koistinen, Ina; Odeberg, Jacob; Fagerberg, Linn; Gummesson, Anders; Bergström, Göran; Uhlén, Mathias; Schwenk, Jochen M. Facets of individual-specific health signatures determined from longitudinal plasma proteome profiling. Ebiomedicine. 2020;57( 32629387):102854. PubMed |