Anti CLEC3A pAb (ATL-HPA051511)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051511-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CLEC3A
Alternative Gene Name: CLECSF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008874: 89%, ENSRNOG00000012238: 87%
Entrez Gene ID: 10143
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DCISKGGILVIPRNSDEINALQDYGKRSLPGVNDFWLGINDMVTEGKFVDVNGIAISFLNWDR |
Gene Sequence | DCISKGGILVIPRNSDEINALQDYGKRSLPGVNDFWLGINDMVTEGKFVDVNGIAISFLNWDR |
Gene ID - Mouse | ENSMUSG00000008874 |
Gene ID - Rat | ENSRNOG00000012238 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CLEC3A pAb (ATL-HPA051511) | |
Datasheet | Anti CLEC3A pAb (ATL-HPA051511) Datasheet (External Link) |
Vendor Page | Anti CLEC3A pAb (ATL-HPA051511) at Atlas Antibodies |
Documents & Links for Anti CLEC3A pAb (ATL-HPA051511) | |
Datasheet | Anti CLEC3A pAb (ATL-HPA051511) Datasheet (External Link) |
Vendor Page | Anti CLEC3A pAb (ATL-HPA051511) |