Anti CLEC2D pAb (ATL-HPA017649)

Atlas Antibodies

Catalog No.:
ATL-HPA017649-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: C-type lectin domain family 2, member D
Gene Name: CLEC2D
Alternative Gene Name: CLAX, LLT1, OCIL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000248: 47%, ENSRNOG00000061757: 47%
Entrez Gene ID: 29121
Uniprot ID: Q9UHP7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RANCHQEPSVCLQAACPESWIGFQRKCFYFSDDTKNWTSSQRFCDSQDADLAQVESFQELNFLLRYKGPSDHWIGLSREQGQPWKWINGTEWTRQFPILGA
Gene Sequence RANCHQEPSVCLQAACPESWIGFQRKCFYFSDDTKNWTSSQRFCDSQDADLAQVESFQELNFLLRYKGPSDHWIGLSREQGQPWKWINGTEWTRQFPILGA
Gene ID - Mouse ENSMUSG00000000248
Gene ID - Rat ENSRNOG00000061757
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CLEC2D pAb (ATL-HPA017649)
Datasheet Anti CLEC2D pAb (ATL-HPA017649) Datasheet (External Link)
Vendor Page Anti CLEC2D pAb (ATL-HPA017649) at Atlas Antibodies

Documents & Links for Anti CLEC2D pAb (ATL-HPA017649)
Datasheet Anti CLEC2D pAb (ATL-HPA017649) Datasheet (External Link)
Vendor Page Anti CLEC2D pAb (ATL-HPA017649)