Anti CLEC2A pAb (ATL-HPA048530)

Atlas Antibodies

Catalog No.:
ATL-HPA048530-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: C-type lectin domain family 2, member A
Gene Name: CLEC2A
Alternative Gene Name: INPE5792, KACL, PILAR, UNQ5792
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030142: 43%, ENSRNOG00000037076: 53%
Entrez Gene ID: 387836
Uniprot ID: Q6UVW9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DDTRNWTASKIFCSLQKAELAQIDTQEDME
Gene Sequence DDTRNWTASKIFCSLQKAELAQIDTQEDME
Gene ID - Mouse ENSMUSG00000030142
Gene ID - Rat ENSRNOG00000037076
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CLEC2A pAb (ATL-HPA048530)
Datasheet Anti CLEC2A pAb (ATL-HPA048530) Datasheet (External Link)
Vendor Page Anti CLEC2A pAb (ATL-HPA048530) at Atlas Antibodies

Documents & Links for Anti CLEC2A pAb (ATL-HPA048530)
Datasheet Anti CLEC2A pAb (ATL-HPA048530) Datasheet (External Link)
Vendor Page Anti CLEC2A pAb (ATL-HPA048530)