Anti CLEC2A pAb (ATL-HPA048530)

Atlas Antibodies

SKU: ATL-HPA048530-25

• 

Protein Description: C-type lectin domain family 2, member A
Gene Name: CLEC2A
Alternative Gene Name: INPE5792, KACL, PILAR, UNQ5792
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030142: 43%, ENSRNOG00000037076: 53%
Entrez Gene ID: 387836
Uniprot ID: Q6UVW9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DDTRNWTASKIFCSLQKAELAQIDTQEDME
• Gene Sequence: DDTRNWTASKIFCSLQKAELAQIDTQEDME
• Gene ID - Mouse: ENSMUSG00000030142
• Gene ID - Rat: ENSRNOG00000037076
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.