Anti CLEC18B pAb (ATL-HPA048976)

Atlas Antibodies

SKU: ATL-HPA048976-25

• 

Protein Description: C-type lectin domain family 18, member B
Gene Name: CLEC18B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033633: 63%, ENSRNOG00000022721: 65%
Entrez Gene ID: 497190
Uniprot ID: Q6UXF7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IPTPSLASGLWRTLQVGWNMQLLPAGLASFVEVVSLWFAEGQRYSHAAGECARNATCTHYTQL
• Gene Sequence: IPTPSLASGLWRTLQVGWNMQLLPAGLASFVEVVSLWFAEGQRYSHAAGECARNATCTHYTQL
• Gene ID - Mouse: ENSMUSG00000033633
• Gene ID - Rat: ENSRNOG00000022721
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.