Anti CLEC16A pAb (ATL-HPA035814 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA035814-25
  • Immunohistochemistry analysis in human testis and pancreas tissues using HPA035814 antibody. Corresponding CLEC16A RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: C-type lectin domain family 16, member A
Gene Name: CLEC16A
Alternative Gene Name: Gop-1, KIAA0350
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068663: 98%, ENSRNOG00000057378: 97%
Entrez Gene ID: 23274
Uniprot ID: Q2KHT3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VPYFSNLVWFIGSHVIELDDCVQTDEEHRNRGKLSDLVAEHLDHLHYLNDILIINCEFLNDVLTDHLLNRLFLPLYVYSLENQDKGGERPKISLPVSLYLLSQVFL
Gene Sequence VPYFSNLVWFIGSHVIELDDCVQTDEEHRNRGKLSDLVAEHLDHLHYLNDILIINCEFLNDVLTDHLLNRLFLPLYVYSLENQDKGGERPKISLPVSLYLLSQVFL
Gene ID - Mouse ENSMUSG00000068663
Gene ID - Rat ENSRNOG00000057378
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti CLEC16A pAb (ATL-HPA035814 w/enhanced validation)
Datasheet Anti CLEC16A pAb (ATL-HPA035814 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CLEC16A pAb (ATL-HPA035814 w/enhanced validation)