Anti CLEC14A pAb (ATL-HPA039468 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA039468-100
  • Immunohistochemical staining of human lung shows strong membranous positivity in respiratory epithelial cells.
  • Immunofluorescent staining of human cell line HUVEC TERT2 shows localization to endoplasmic reticulum & the Golgi apparatus.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and CLEC14A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY406300).
Shipping:
Calculated at Checkout
$554.00
Adding to cart… The item has been added
Protein Description: C-type lectin domain family 14, member A
Gene Name: CLEC14A
Alternative Gene Name: C14orf27
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045930: 64%, ENSRNOG00000022697: 64%
Entrez Gene ID: 161198
Uniprot ID: Q86T13
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ARWDKLSGDVLCPCPGRYLRAGKCAELPNCLDDLGGFACECATGFELGKDGRSCVTSGEGQPTLGGTGVPTRRPPATATSPVPQRTWPIRVDEKL
Gene Sequence ARWDKLSGDVLCPCPGRYLRAGKCAELPNCLDDLGGFACECATGFELGKDGRSCVTSGEGQPTLGGTGVPTRRPPATATSPVPQRTWPIRVDEKL
Gene ID - Mouse ENSMUSG00000045930
Gene ID - Rat ENSRNOG00000022697
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti CLEC14A pAb (ATL-HPA039468 w/enhanced validation)
Datasheet Anti CLEC14A pAb (ATL-HPA039468 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CLEC14A pAb (ATL-HPA039468 w/enhanced validation)