Anti CLEC11A pAb (ATL-HPA042690)

Atlas Antibodies

SKU:
ATL-HPA042690-25
  • Immunohistochemical staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to centrosome.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: C-type lectin domain family 11, member A
Gene Name: CLEC11A
Alternative Gene Name: CLECSF3, LSLCL, P47, SCGF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004473: 86%, ENSRNOG00000019138: 88%
Entrez Gene ID: 6320
Uniprot ID: Q9Y240
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LYLFENGQRVSFFAWHRSPRPELGAQPSASPHPLSPDQPNGGTLENCVAQASDDGSWWDHDCQRRLYYVCEFPF
Gene Sequence LYLFENGQRVSFFAWHRSPRPELGAQPSASPHPLSPDQPNGGTLENCVAQASDDGSWWDHDCQRRLYYVCEFPF
Gene ID - Mouse ENSMUSG00000004473
Gene ID - Rat ENSRNOG00000019138
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CLEC11A pAb (ATL-HPA042690)
Datasheet Anti CLEC11A pAb (ATL-HPA042690) Datasheet (External Link)
Vendor Page Anti CLEC11A pAb (ATL-HPA042690) at Atlas Antibodies

Documents & Links for Anti CLEC11A pAb (ATL-HPA042690)
Datasheet Anti CLEC11A pAb (ATL-HPA042690) Datasheet (External Link)
Vendor Page Anti CLEC11A pAb (ATL-HPA042690)