Anti CLDND1 pAb (ATL-HPA029841)

Atlas Antibodies

Catalog No.:
ATL-HPA029841-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: claudin domain containing 1
Gene Name: CLDND1
Alternative Gene Name: C3orf4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022744: 91%, ENSRNOG00000001657: 89%
Entrez Gene ID: 56650
Uniprot ID: Q9NY35
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NMHWYSPPERTESFDVVTKCVSFTLTEQFMEKFVDPGNHNSGIDLLRTYLWRC
Gene Sequence NMHWYSPPERTESFDVVTKCVSFTLTEQFMEKFVDPGNHNSGIDLLRTYLWRC
Gene ID - Mouse ENSMUSG00000022744
Gene ID - Rat ENSRNOG00000001657
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CLDND1 pAb (ATL-HPA029841)
Datasheet Anti CLDND1 pAb (ATL-HPA029841) Datasheet (External Link)
Vendor Page Anti CLDND1 pAb (ATL-HPA029841) at Atlas Antibodies

Documents & Links for Anti CLDND1 pAb (ATL-HPA029841)
Datasheet Anti CLDND1 pAb (ATL-HPA029841) Datasheet (External Link)
Vendor Page Anti CLDND1 pAb (ATL-HPA029841)