Anti CLDND1 pAb (ATL-HPA029841)

Atlas Antibodies

SKU:
ATL-HPA029841-100
  • Immunohistochemical staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & nucleoli.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and CLDND1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY412679).
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: claudin domain containing 1
Gene Name: CLDND1
Alternative Gene Name: C3orf4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022744: 91%, ENSRNOG00000001657: 89%
Entrez Gene ID: 56650
Uniprot ID: Q9NY35
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NMHWYSPPERTESFDVVTKCVSFTLTEQFMEKFVDPGNHNSGIDLLRTYLWRC
Gene Sequence NMHWYSPPERTESFDVVTKCVSFTLTEQFMEKFVDPGNHNSGIDLLRTYLWRC
Gene ID - Mouse ENSMUSG00000022744
Gene ID - Rat ENSRNOG00000001657
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CLDND1 pAb (ATL-HPA029841)
Datasheet Anti CLDND1 pAb (ATL-HPA029841) Datasheet (External Link)
Vendor Page Anti CLDND1 pAb (ATL-HPA029841) at Atlas Antibodies

Documents & Links for Anti CLDND1 pAb (ATL-HPA029841)
Datasheet Anti CLDND1 pAb (ATL-HPA029841) Datasheet (External Link)
Vendor Page Anti CLDND1 pAb (ATL-HPA029841)