Anti CLDN9 pAb (ATL-HPA076613)
Atlas Antibodies
- Catalog No.:
- ATL-HPA076613-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CLDN9
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066720: 92%, ENSRNOG00000003654: 92%
Entrez Gene ID: 9080
Uniprot ID: O95484
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GLLCCTCPPPQVERPRGPRLGYSIPSRSGASGLDKRDYV |
Gene Sequence | GLLCCTCPPPQVERPRGPRLGYSIPSRSGASGLDKRDYV |
Gene ID - Mouse | ENSMUSG00000066720 |
Gene ID - Rat | ENSRNOG00000003654 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CLDN9 pAb (ATL-HPA076613) | |
Datasheet | Anti CLDN9 pAb (ATL-HPA076613) Datasheet (External Link) |
Vendor Page | Anti CLDN9 pAb (ATL-HPA076613) at Atlas Antibodies |
Documents & Links for Anti CLDN9 pAb (ATL-HPA076613) | |
Datasheet | Anti CLDN9 pAb (ATL-HPA076613) Datasheet (External Link) |
Vendor Page | Anti CLDN9 pAb (ATL-HPA076613) |