Anti CLDN7 pAb (ATL-HPA014703 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA014703-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: claudin 7
Gene Name: CLDN7
Alternative Gene Name: CEPTRL2, CPETRL2, Hs.84359
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018569: 96%, ENSRNOG00000017325: 96%
Entrez Gene ID: 1366
Uniprot ID: O95471
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTGMMSCKMYDSVLALS
Gene Sequence PQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTGMMSCKMYDSVLALS
Gene ID - Mouse ENSMUSG00000018569
Gene ID - Rat ENSRNOG00000017325
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CLDN7 pAb (ATL-HPA014703 w/enhanced validation)
Datasheet Anti CLDN7 pAb (ATL-HPA014703 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CLDN7 pAb (ATL-HPA014703 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CLDN7 pAb (ATL-HPA014703 w/enhanced validation)
Datasheet Anti CLDN7 pAb (ATL-HPA014703 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CLDN7 pAb (ATL-HPA014703 w/enhanced validation)