Anti CLDN7 pAb (ATL-HPA014703 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA014703-25

• 

Protein Description: claudin 7
Gene Name: CLDN7
Alternative Gene Name: CEPTRL2, CPETRL2, Hs.84359
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018569: 96%, ENSRNOG00000017325: 96%
Entrez Gene ID: 1366
Uniprot ID: O95471
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTGMMSCKMYDSVLALS
• Gene Sequence: PQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTGMMSCKMYDSVLALS
• Gene ID - Mouse: ENSMUSG00000018569
• Gene ID - Rat: ENSRNOG00000017325
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.