Anti CLDN17 pAb (ATL-HPA045903 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA045903-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: claudin 17
Gene Name: CLDN17
Alternative Gene Name: MGC126552, MGC126554
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055811: 62%, ENSRNOG00000027691: 59%
Entrez Gene ID: 26285
Uniprot ID: P56750
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CNRKKQGYRYPVPGYRVPHTDKRRNTTMLSKTSTSYV
Gene Sequence CNRKKQGYRYPVPGYRVPHTDKRRNTTMLSKTSTSYV
Gene ID - Mouse ENSMUSG00000055811
Gene ID - Rat ENSRNOG00000027691
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CLDN17 pAb (ATL-HPA045903 w/enhanced validation)
Datasheet Anti CLDN17 pAb (ATL-HPA045903 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CLDN17 pAb (ATL-HPA045903 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CLDN17 pAb (ATL-HPA045903 w/enhanced validation)
Datasheet Anti CLDN17 pAb (ATL-HPA045903 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CLDN17 pAb (ATL-HPA045903 w/enhanced validation)