Anti CLDN17 pAb (ATL-HPA045903 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA045903-25

Protein Description: claudin 17
Gene Name: CLDN17
Alternative Gene Name: MGC126552, MGC126554
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055811: 62%, ENSRNOG00000027691: 59%
Entrez Gene ID: 26285
Uniprot ID: P56750
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CNRKKQGYRYPVPGYRVPHTDKRRNTTMLSKTSTSYV
• Gene Sequence: CNRKKQGYRYPVPGYRVPHTDKRRNTTMLSKTSTSYV
• Gene ID - Mouse: ENSMUSG00000055811
• Gene ID - Rat: ENSRNOG00000027691
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.