Anti CLDN12 pAb (ATL-HPA026945)

Atlas Antibodies

Catalog No.:
ATL-HPA026945-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: claudin 12
Gene Name: CLDN12
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046798: 89%, ENSRNOG00000039862: 91%
Entrez Gene ID: 9069
Uniprot ID: P56749
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLPSPFWQPLYSHPPSMHTYSQPYSARSRLSAIEIDIPVVSHTT
Gene Sequence SLPSPFWQPLYSHPPSMHTYSQPYSARSRLSAIEIDIPVVSHTT
Gene ID - Mouse ENSMUSG00000046798
Gene ID - Rat ENSRNOG00000039862
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CLDN12 pAb (ATL-HPA026945)
Datasheet Anti CLDN12 pAb (ATL-HPA026945) Datasheet (External Link)
Vendor Page Anti CLDN12 pAb (ATL-HPA026945) at Atlas Antibodies

Documents & Links for Anti CLDN12 pAb (ATL-HPA026945)
Datasheet Anti CLDN12 pAb (ATL-HPA026945) Datasheet (External Link)
Vendor Page Anti CLDN12 pAb (ATL-HPA026945)