Anti CLDN10 pAb (ATL-HPA042348 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042348-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: CLDN10
Alternative Gene Name: CPETRL3, OSP-L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022132: 79%, ENSRNOG00000010085: 82%
Entrez Gene ID: 9071
Uniprot ID: P78369
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ISDNNKTPRYTYNGATSVMSSRTKYHGGEDF |
| Gene Sequence | ISDNNKTPRYTYNGATSVMSSRTKYHGGEDF |
| Gene ID - Mouse | ENSMUSG00000022132 |
| Gene ID - Rat | ENSRNOG00000010085 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CLDN10 pAb (ATL-HPA042348 w/enhanced validation) | |
| Datasheet | Anti CLDN10 pAb (ATL-HPA042348 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CLDN10 pAb (ATL-HPA042348 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CLDN10 pAb (ATL-HPA042348 w/enhanced validation) | |
| Datasheet | Anti CLDN10 pAb (ATL-HPA042348 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CLDN10 pAb (ATL-HPA042348 w/enhanced validation) |
| Citations for Anti CLDN10 pAb (ATL-HPA042348 w/enhanced validation) – 1 Found |
| Krivanek, Jan; Soldatov, Ruslan A; Kastriti, Maria Eleni; Chontorotzea, Tatiana; Herdina, Anna Nele; Petersen, Julian; Szarowska, Bara; Landova, Marie; Matejova, Veronika Kovar; Holla, Lydie Izakovicova; Kuchler, Ulrike; Zdrilic, Ivana Vidovic; Vijaykumar, Anushree; Balic, Anamaria; Marangoni, Pauline; Klein, Ophir D; Neves, Vitor C M; Yianni, Val; Sharpe, Paul T; Harkany, Tibor; Metscher, Brian D; Bajénoff, Marc; Mina, Mina; Fried, Kaj; Kharchenko, Peter V; Adameyko, Igor. Dental cell type atlas reveals stem and differentiated cell types in mouse and human teeth. Nature Communications. 2020;11(1):4816. PubMed |