Anti CLDN10 pAb (ATL-HPA042348 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA042348-25

Protein Description: claudin 10
Gene Name: CLDN10
Alternative Gene Name: CPETRL3, OSP-L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022132: 79%, ENSRNOG00000010085: 82%
Entrez Gene ID: 9071
Uniprot ID: P78369
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ISDNNKTPRYTYNGATSVMSSRTKYHGGEDF
• Gene Sequence: ISDNNKTPRYTYNGATSVMSSRTKYHGGEDF
• Gene ID - Mouse: ENSMUSG00000022132
• Gene ID - Rat: ENSRNOG00000010085
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CLDN10 pAb (ATL-HPA042348 w/enhanced validation) – 1 Found

Krivanek, Jan; Soldatov, Ruslan A; Kastriti, Maria Eleni; Chontorotzea, Tatiana; Herdina, Anna Nele; Petersen, Julian; Szarowska, Bara; Landova, Marie; Matejova, Veronika Kovar; Holla, Lydie Izakovicova; Kuchler, Ulrike; Zdrilic, Ivana Vidovic; Vijaykumar, Anushree; Balic, Anamaria; Marangoni, Pauline; Klein, Ophir D; Neves, Vitor C M; Yianni, Val; Sharpe, Paul T; Harkany, Tibor; Metscher, Brian D; Bajénoff, Marc; Mina, Mina; Fried, Kaj; Kharchenko, Peter V; Adameyko, Igor. Dental cell type atlas reveals stem and differentiated cell types in mouse and human teeth. Nature Communications. 2020;11(1):4816.