Anti CLCNKA pAb (ATL-HPA057717)

Atlas Antibodies

Catalog No.:
ATL-HPA057717-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: chloride channel, voltage-sensitive Ka
Gene Name: CLCNKA
Alternative Gene Name: hClC-Ka
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006216: 74%, ENSRNOG00000009897: 74%
Entrez Gene ID: 1187
Uniprot ID: P51800
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IVKKLPYLPRILGRNIGSHHVRVEHFMNHSITTLA
Gene Sequence IVKKLPYLPRILGRNIGSHHVRVEHFMNHSITTLA
Gene ID - Mouse ENSMUSG00000006216
Gene ID - Rat ENSRNOG00000009897
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CLCNKA pAb (ATL-HPA057717)
Datasheet Anti CLCNKA pAb (ATL-HPA057717) Datasheet (External Link)
Vendor Page Anti CLCNKA pAb (ATL-HPA057717) at Atlas Antibodies

Documents & Links for Anti CLCNKA pAb (ATL-HPA057717)
Datasheet Anti CLCNKA pAb (ATL-HPA057717) Datasheet (External Link)
Vendor Page Anti CLCNKA pAb (ATL-HPA057717)