Anti CLCNKA pAb (ATL-HPA057717)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057717-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CLCNKA
Alternative Gene Name: hClC-Ka
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006216: 74%, ENSRNOG00000009897: 74%
Entrez Gene ID: 1187
Uniprot ID: P51800
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | IVKKLPYLPRILGRNIGSHHVRVEHFMNHSITTLA |
Gene Sequence | IVKKLPYLPRILGRNIGSHHVRVEHFMNHSITTLA |
Gene ID - Mouse | ENSMUSG00000006216 |
Gene ID - Rat | ENSRNOG00000009897 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CLCNKA pAb (ATL-HPA057717) | |
Datasheet | Anti CLCNKA pAb (ATL-HPA057717) Datasheet (External Link) |
Vendor Page | Anti CLCNKA pAb (ATL-HPA057717) at Atlas Antibodies |
Documents & Links for Anti CLCNKA pAb (ATL-HPA057717) | |
Datasheet | Anti CLCNKA pAb (ATL-HPA057717) Datasheet (External Link) |
Vendor Page | Anti CLCNKA pAb (ATL-HPA057717) |