Anti CLCNKA pAb (ATL-HPA057717)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057717-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: CLCNKA
Alternative Gene Name: hClC-Ka
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006216: 74%, ENSRNOG00000009897: 74%
Entrez Gene ID: 1187
Uniprot ID: P51800
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IVKKLPYLPRILGRNIGSHHVRVEHFMNHSITTLA |
| Gene Sequence | IVKKLPYLPRILGRNIGSHHVRVEHFMNHSITTLA |
| Gene ID - Mouse | ENSMUSG00000006216 |
| Gene ID - Rat | ENSRNOG00000009897 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CLCNKA pAb (ATL-HPA057717) | |
| Datasheet | Anti CLCNKA pAb (ATL-HPA057717) Datasheet (External Link) |
| Vendor Page | Anti CLCNKA pAb (ATL-HPA057717) at Atlas Antibodies |
| Documents & Links for Anti CLCNKA pAb (ATL-HPA057717) | |
| Datasheet | Anti CLCNKA pAb (ATL-HPA057717) Datasheet (External Link) |
| Vendor Page | Anti CLCNKA pAb (ATL-HPA057717) |