Anti CLCN7 pAb (ATL-HPA043586)

Atlas Antibodies

Catalog No.:
ATL-HPA043586-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: chloride channel, voltage-sensitive 7
Gene Name: CLCN7
Alternative Gene Name: CLC-7, CLC7, OPTA2, PPP1R63
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036636: 99%, ENSRNOG00000016976: 99%
Entrez Gene ID: 1186
Uniprot ID: P51798
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LRLKDFRDAYPRFPPIQSIHVSQDERECTMDLSEFMNPSPYTVPQEASLPRVFKLFRALGLRHLVVVDNRNQVVGLVT
Gene Sequence LRLKDFRDAYPRFPPIQSIHVSQDERECTMDLSEFMNPSPYTVPQEASLPRVFKLFRALGLRHLVVVDNRNQVVGLVT
Gene ID - Mouse ENSMUSG00000036636
Gene ID - Rat ENSRNOG00000016976
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CLCN7 pAb (ATL-HPA043586)
Datasheet Anti CLCN7 pAb (ATL-HPA043586) Datasheet (External Link)
Vendor Page Anti CLCN7 pAb (ATL-HPA043586) at Atlas Antibodies

Documents & Links for Anti CLCN7 pAb (ATL-HPA043586)
Datasheet Anti CLCN7 pAb (ATL-HPA043586) Datasheet (External Link)
Vendor Page Anti CLCN7 pAb (ATL-HPA043586)