Anti CLCN7 pAb (ATL-HPA043586)

Atlas Antibodies

SKU: ATL-HPA043586-25

• 
• 

Protein Description: chloride channel, voltage-sensitive 7
Gene Name: CLCN7
Alternative Gene Name: CLC-7, CLC7, OPTA2, PPP1R63
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036636: 99%, ENSRNOG00000016976: 99%
Entrez Gene ID: 1186
Uniprot ID: P51798
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LRLKDFRDAYPRFPPIQSIHVSQDERECTMDLSEFMNPSPYTVPQEASLPRVFKLFRALGLRHLVVVDNRNQVVGLVT
• Gene Sequence: LRLKDFRDAYPRFPPIQSIHVSQDERECTMDLSEFMNPSPYTVPQEASLPRVFKLFRALGLRHLVVVDNRNQVVGLVT
• Gene ID - Mouse: ENSMUSG00000036636
• Gene ID - Rat: ENSRNOG00000016976
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.