Anti CLCN6 pAb (ATL-HPA032097)

Atlas Antibodies

SKU: ATL-HPA032097-25

• 

Protein Description: chloride channel, voltage-sensitive 6
Gene Name: CLCN6
Alternative Gene Name: CLC-6, KIAA0046
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029016: 97%, ENSRNOG00000008345: 98%
Entrez Gene ID: 1185
Uniprot ID: P51797
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KGIYDIHVGLRGVPLLEWETEVEMDKLRASDIMEPNLTYVYPHTRIQSLVSILRTTVHHAFPVVTENRGNEKEFMKGNQLISNNIKFKKSSILT
• Gene Sequence: KGIYDIHVGLRGVPLLEWETEVEMDKLRASDIMEPNLTYVYPHTRIQSLVSILRTTVHHAFPVVTENRGNEKEFMKGNQLISNNIKFKKSSILT
• Gene ID - Mouse: ENSMUSG00000029016
• Gene ID - Rat: ENSRNOG00000008345
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CLCN6 pAb (ATL-HPA032097) – 1 Found

Luo, Yong; Liu, Xiaopeng; Li, Xiaoxiao; Zhong, Weide; Lin, Jingbo; Chen, Qingbiao. Identification and validation of a signature involving voltage-gated chloride ion channel genes for prediction of prostate cancer recurrence. Frontiers In Endocrinology. 13( 36246902):1001634.