Anti CLCN5 pAb (ATL-HPA003213)
Atlas Antibodies
- Catalog No.:
- ATL-HPA003213-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CLCN5
Alternative Gene Name: ClC-5, CLC5, DENTS, hCIC-K2, hClC-K2, NPHL1, NPHL2, XLRH, XRN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004317: 91%, ENSRNOG00000002862: 91%
Entrez Gene ID: 1184
Uniprot ID: P51795
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MAMWQGAMDNRGFQQGSFSSFQNSSSDEDLMDIPATAMDFSMRDDVPPLDREVG |
| Gene Sequence | MAMWQGAMDNRGFQQGSFSSFQNSSSDEDLMDIPATAMDFSMRDDVPPLDREVG |
| Gene ID - Mouse | ENSMUSG00000004317 |
| Gene ID - Rat | ENSRNOG00000002862 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CLCN5 pAb (ATL-HPA003213) | |
| Datasheet | Anti CLCN5 pAb (ATL-HPA003213) Datasheet (External Link) |
| Vendor Page | Anti CLCN5 pAb (ATL-HPA003213) at Atlas Antibodies |
| Documents & Links for Anti CLCN5 pAb (ATL-HPA003213) | |
| Datasheet | Anti CLCN5 pAb (ATL-HPA003213) Datasheet (External Link) |
| Vendor Page | Anti CLCN5 pAb (ATL-HPA003213) |
| Citations for Anti CLCN5 pAb (ATL-HPA003213) – 1 Found |
| Vázquez-Román, V; Cameselle-Teijeiro, J M; Fernández-Santos, J M; Ríos-Moreno, M J; Loidi, L; Ortiz, T; Martín-Lacave, I. Histopathological Features of Pendred Syndrome Thyroids Align with Differences in the Expression of Thyroid-Specific Markers, Apical Iodide Transporters, and Ciliogenesis Process. Endocrine Pathology. 2022;33(4):484-493. PubMed |