Anti CLCN5 pAb (ATL-HPA000401)

Atlas Antibodies

SKU: ATL-HPA000401-25

• 

Protein Description: chloride channel, voltage-sensitive 5
Gene Name: CLCN5
Alternative Gene Name: ClC-5, CLC5, DENTS, hCIC-K2, hClC-K2, NPHL1, NPHL2, XLRH, XRN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004317: 98%, ENSRNOG00000002862: 98%
Entrez Gene ID: 1184
Uniprot ID: P51795
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EAKEEFAHKTLAMDVMKPRRNDPLLTVLTQDSMTVEDVETIISETTYSGFPVVVSRESQRLVGFVLRRDLIISIENARKKQDGVVSTSIIYFTEHSPPLPPYTPPTLKLQNILDLSPFTVTD
• Gene Sequence: EAKEEFAHKTLAMDVMKPRRNDPLLTVLTQDSMTVEDVETIISETTYSGFPVVVSRESQRLVGFVLRRDLIISIENARKKQDGVVSTSIIYFTEHSPPLPPYTPPTLKLQNILDLSPFTVTD
• Gene ID - Mouse: ENSMUSG00000004317
• Gene ID - Rat: ENSRNOG00000002862
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CLCN5 pAb (ATL-HPA000401) – 3 Found

Ceol, Monica; Tiralongo, Emilia; Baelde, Hans J; Vianello, Daniela; Betto, Giovanni; Marangelli, Annunziata; Bonfante, Luciana; Valente, Marialuisa; Della Barbera, Mila; D'Angelo, Angela; Anglani, Franca; Del Prete, Dorella. Involvement of the tubular ClC-type exchanger ClC-5 in glomeruli of human proteinuric nephropathies. Plos One. 7(9):e45605. 

Gianesello, Lisa; Ceol, Monica; Bertoldi, Loris; Terrin, Liliana; Priante, Giovanna; Murer, Luisa; Peruzzi, Licia; Giordano, Mario; Paglialonga, Fabio; Cantaluppi, Vincenzo; Musetti, Claudio; Valle, Giorgio; Del Prete, Dorella; Anglani, Franca; Network, Dent Disease Italian. Genetic Analyses in Dent Disease and Characterization of CLCN5 Mutations in Kidney Biopsies. International Journal Of Molecular Sciences. 2020;21(2) 

Shi, Zhe; Zhou, Liyuan; Zhou, Yan; Jia, Xiaoyan; Yu, Xiangjun; An, Xiaohong; Han, Yanzhen. Inhibition of ClC-5 suppresses proliferation and induces apoptosis in cholangiocarcinoma cells through the Wnt/β-catenin signaling pathway. Bmb Reports. 2022;55(6):299-304.