Anti CLCN5 pAb (ATL-HPA000401)
Atlas Antibodies
- Catalog No.:
- ATL-HPA000401-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CLCN5
Alternative Gene Name: ClC-5, CLC5, DENTS, hCIC-K2, hClC-K2, NPHL1, NPHL2, XLRH, XRN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004317: 98%, ENSRNOG00000002862: 98%
Entrez Gene ID: 1184
Uniprot ID: P51795
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EAKEEFAHKTLAMDVMKPRRNDPLLTVLTQDSMTVEDVETIISETTYSGFPVVVSRESQRLVGFVLRRDLIISIENARKKQDGVVSTSIIYFTEHSPPLPPYTPPTLKLQNILDLSPFTVTD |
Gene Sequence | EAKEEFAHKTLAMDVMKPRRNDPLLTVLTQDSMTVEDVETIISETTYSGFPVVVSRESQRLVGFVLRRDLIISIENARKKQDGVVSTSIIYFTEHSPPLPPYTPPTLKLQNILDLSPFTVTD |
Gene ID - Mouse | ENSMUSG00000004317 |
Gene ID - Rat | ENSRNOG00000002862 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CLCN5 pAb (ATL-HPA000401) | |
Datasheet | Anti CLCN5 pAb (ATL-HPA000401) Datasheet (External Link) |
Vendor Page | Anti CLCN5 pAb (ATL-HPA000401) at Atlas Antibodies |
Documents & Links for Anti CLCN5 pAb (ATL-HPA000401) | |
Datasheet | Anti CLCN5 pAb (ATL-HPA000401) Datasheet (External Link) |
Vendor Page | Anti CLCN5 pAb (ATL-HPA000401) |
Citations for Anti CLCN5 pAb (ATL-HPA000401) – 3 Found |
Ceol, Monica; Tiralongo, Emilia; Baelde, Hans J; Vianello, Daniela; Betto, Giovanni; Marangelli, Annunziata; Bonfante, Luciana; Valente, Marialuisa; Della Barbera, Mila; D'Angelo, Angela; Anglani, Franca; Del Prete, Dorella. Involvement of the tubular ClC-type exchanger ClC-5 in glomeruli of human proteinuric nephropathies. Plos One. 7(9):e45605. PubMed |
Gianesello, Lisa; Ceol, Monica; Bertoldi, Loris; Terrin, Liliana; Priante, Giovanna; Murer, Luisa; Peruzzi, Licia; Giordano, Mario; Paglialonga, Fabio; Cantaluppi, Vincenzo; Musetti, Claudio; Valle, Giorgio; Del Prete, Dorella; Anglani, Franca; Network, Dent Disease Italian. Genetic Analyses in Dent Disease and Characterization of CLCN5 Mutations in Kidney Biopsies. International Journal Of Molecular Sciences. 2020;21(2) PubMed |
Shi, Zhe; Zhou, Liyuan; Zhou, Yan; Jia, Xiaoyan; Yu, Xiangjun; An, Xiaohong; Han, Yanzhen. Inhibition of ClC-5 suppresses proliferation and induces apoptosis in cholangiocarcinoma cells through the Wnt/β-catenin signaling pathway. Bmb Reports. 2022;55(6):299-304. PubMed |