Anti CLCN3 pAb (ATL-HPA044723)

Atlas Antibodies

SKU: ATL-HPA044723-25

• 
• 

Protein Description: chloride channel, voltage-sensitive 3
Gene Name: CLCN3
Alternative Gene Name: ClC-3, CLC3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004319: 97%, ENSRNOG00000010682: 97%
Entrez Gene ID: 1182
Uniprot ID: P51790
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NSITSASSDEELLDGAGVIMDFQTSEDDNLLDGDTAVGTHYTMTNGGSINSSTHLLDLLDEP
• Gene Sequence: NSITSASSDEELLDGAGVIMDFQTSEDDNLLDGDTAVGTHYTMTNGGSINSSTHLLDLLDEP
• Gene ID - Mouse: ENSMUSG00000004319
• Gene ID - Rat: ENSRNOG00000010682
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.