Anti CLCN2 pAb (ATL-HPA014545)

Atlas Antibodies

Catalog No.: ATL-HPA014545-25

Protein Description: chloride channel, voltage-sensitive 2
Gene Name: CLCN2
Alternative Gene Name: ClC-2, CLC2, EJM6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022843: 99%, ENSRNOG00000050854: 99%
Entrez Gene ID: 1181
Uniprot ID: P51788
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GVDHAYVTSIGRLIGIVTLKELRKAIEGSVTAQGVKVRPPLASFRDSATSSSDTETTEVHALWGPHSRHG
• Gene Sequence: GVDHAYVTSIGRLIGIVTLKELRKAIEGSVTAQGVKVRPPLASFRDSATSSSDTETTEVHALWGPHSRHG
• Gene ID - Mouse: ENSMUSG00000022843
• Gene ID - Rat: ENSRNOG00000050854
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CLCN2 pAb (ATL-HPA014545) – 1 Found

Scholl, Ute I; Stölting, Gabriel; Schewe, Julia; Thiel, Anne; Tan, Hua; Nelson-Williams, Carol; Vichot, Alfred A; Jin, Sheng Chih; Loring, Erin; Untiet, Verena; Yoo, Taekyeong; Choi, Jungmin; Xu, Shengxin; Wu, Aihua; Kirchner, Marieluise; Mertins, Philipp; Rump, Lars C; Onder, Ali Mirza; Gamble, Cory; McKenney, Daniel; Lash, Robert W; Jones, Deborah P; Chune, Gary; Gagliardi, Priscila; Choi, Murim; Gordon, Richard; Stowasser, Michael; Fahlke, Christoph; Lifton, Richard P. CLCN2 chloride channel mutations in familial hyperaldosteronism type II. Nature Genetics. 2018;50(3):349-354.