Anti CLCF1 pAb (ATL-HPA042444)

Atlas Antibodies

Catalog No.: ATL-HPA042444-25

Protein Description: cardiotrophin-like cytokine factor 1
Gene Name: CLCF1
Alternative Gene Name: BSF-3, BSF3, CISS2, CLC, NNT-1, NNT1, NR6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000097629: 97%, ENSRNOG00000018752: 97%
Entrez Gene ID: 23529
Uniprot ID: Q9UBD9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KTYDLTRYLEHQLRSLAGTYLNYLGPPFNEPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQNYE
• Gene Sequence: KTYDLTRYLEHQLRSLAGTYLNYLGPPFNEPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQNYE
• Gene ID - Mouse: ENSMUSG00000097629
• Gene ID - Rat: ENSRNOG00000018752
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CLCF1 pAb (ATL-HPA042444) – 1 Found

Zhang, Zhongqiang; Tan, Xiao; Luo, Jing; Yao, Hongliang; Si, Zhongzhou; Tong, Jing-Shan. The miR-30a-5p/CLCF1 axis regulates sorafenib resistance and aerobic glycolysis in hepatocellular carcinoma. Cell Death & Disease. 2020;11(10):902.