Anti CLCF1 pAb (ATL-HPA042444)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042444-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: CLCF1
Alternative Gene Name: BSF-3, BSF3, CISS2, CLC, NNT-1, NNT1, NR6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000097629: 97%, ENSRNOG00000018752: 97%
Entrez Gene ID: 23529
Uniprot ID: Q9UBD9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KTYDLTRYLEHQLRSLAGTYLNYLGPPFNEPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQNYE |
| Gene Sequence | KTYDLTRYLEHQLRSLAGTYLNYLGPPFNEPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQNYE |
| Gene ID - Mouse | ENSMUSG00000097629 |
| Gene ID - Rat | ENSRNOG00000018752 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CLCF1 pAb (ATL-HPA042444) | |
| Datasheet | Anti CLCF1 pAb (ATL-HPA042444) Datasheet (External Link) |
| Vendor Page | Anti CLCF1 pAb (ATL-HPA042444) at Atlas Antibodies |
| Documents & Links for Anti CLCF1 pAb (ATL-HPA042444) | |
| Datasheet | Anti CLCF1 pAb (ATL-HPA042444) Datasheet (External Link) |
| Vendor Page | Anti CLCF1 pAb (ATL-HPA042444) |
| Citations for Anti CLCF1 pAb (ATL-HPA042444) – 1 Found |
| Zhang, Zhongqiang; Tan, Xiao; Luo, Jing; Yao, Hongliang; Si, Zhongzhou; Tong, Jing-Shan. The miR-30a-5p/CLCF1 axis regulates sorafenib resistance and aerobic glycolysis in hepatocellular carcinoma. Cell Death & Disease. 2020;11(10):902. PubMed |