Anti CLCC1 pAb (ATL-HPA013210 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA013210-25
  • Immunohistochemical staining of human cerebellum, endometrium, kidney and testis using Anti-CLCC1 antibody HPA013210 (A) shows similar protein distribution across tissues to independent antibody HPA009087 (B).
  • Immunofluorescent staining of human cell line U-251 MG shows localization to endoplasmic reticulum & vesicles.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: chloride channel CLIC-like 1
Gene Name: CLCC1
Alternative Gene Name: MCLC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027884: 79%, ENSRNOG00000020360: 81%
Entrez Gene ID: 23155
Uniprot ID: Q96S66
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HDDDWIDPTDMLNYDAASGTMRKSQAKYGISGEKDVSPDLSCADEISECYHKLDSLTYKIDECEKKKREDYESQSNPVFRRYLNKILIEAGKLGLL
Gene Sequence HDDDWIDPTDMLNYDAASGTMRKSQAKYGISGEKDVSPDLSCADEISECYHKLDSLTYKIDECEKKKREDYESQSNPVFRRYLNKILIEAGKLGLL
Gene ID - Mouse ENSMUSG00000027884
Gene ID - Rat ENSRNOG00000020360
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CLCC1 pAb (ATL-HPA013210 w/enhanced validation)
Datasheet Anti CLCC1 pAb (ATL-HPA013210 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CLCC1 pAb (ATL-HPA013210 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CLCC1 pAb (ATL-HPA013210 w/enhanced validation)
Datasheet Anti CLCC1 pAb (ATL-HPA013210 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CLCC1 pAb (ATL-HPA013210 w/enhanced validation)



Citations for Anti CLCC1 pAb (ATL-HPA013210 w/enhanced validation) – 1 Found
Li, Lin; Jiao, Xiaodong; D'Atri, Ilaria; Ono, Fumihito; Nelson, Ralph; Chan, Chi-Chao; Nakaya, Naoki; Ma, Zhiwei; Ma, Yan; Cai, Xiaoying; Zhang, Longhua; Lin, Siying; Hameed, Abdul; Chioza, Barry A; Hardy, Holly; Arno, Gavin; Hull, Sarah; Khan, Muhammad Imran; Fasham, James; Harlalka, Gaurav V; Michaelides, Michel; Moore, Anthony T; Coban Akdemir, Zeynep Hande; Jhangiani, Shalini; Lupski, James R; Cremers, Frans P M; Qamar, Raheel; Salman, Ahmed; Chilton, John; Self, Jay; Ayyagari, Radha; Kabir, Firoz; Naeem, Muhammad Asif; Ali, Muhammad; Akram, Javed; Sieving, Paul A; Riazuddin, Sheikh; Baple, Emma L; Riazuddin, S Amer; Crosby, Andrew H; Hejtmancik, J Fielding. Mutation in the intracellular chloride channel CLCC1 associated with autosomal recessive retinitis pigmentosa. Plos Genetics. 2018;14(8):e1007504.  PubMed