Anti CLCA4 pAb (ATL-HPA064770)

Atlas Antibodies

SKU:
ATL-HPA064770-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & plasma membrane.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chloride channel accessory 4
Gene Name: CLCA4
Alternative Gene Name: CaCC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068547: 80%, ENSRNOG00000029889: 75%
Entrez Gene ID: 22802
Uniprot ID: Q14CN2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NEDQPFYRAKSKKIEATRCSAGISGRNRVYKCQGGSCLSRACRIDSTTKLYGKDCQFFPDKVQT
Gene Sequence NEDQPFYRAKSKKIEATRCSAGISGRNRVYKCQGGSCLSRACRIDSTTKLYGKDCQFFPDKVQT
Gene ID - Mouse ENSMUSG00000068547
Gene ID - Rat ENSRNOG00000029889
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CLCA4 pAb (ATL-HPA064770)
Datasheet Anti CLCA4 pAb (ATL-HPA064770) Datasheet (External Link)
Vendor Page Anti CLCA4 pAb (ATL-HPA064770) at Atlas Antibodies

Documents & Links for Anti CLCA4 pAb (ATL-HPA064770)
Datasheet Anti CLCA4 pAb (ATL-HPA064770) Datasheet (External Link)
Vendor Page Anti CLCA4 pAb (ATL-HPA064770)