Anti CLC pAb (ATL-HPA041751 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA041751-25

Protein Description: Charcot-Leyden crystal galectin
Gene Name: CLC
Alternative Gene Name: Gal-10, LGALS10, MGC149659
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053964: 32%, ENSRNOG00000012681: 33%
Entrez Gene ID: 1178
Uniprot ID: Q05315
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LACFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVM
• Gene Sequence: LACFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVM
• Gene ID - Mouse: ENSMUSG00000053964
• Gene ID - Rat: ENSRNOG00000012681
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.