Anti CLASRP pAb (ATL-HPA060469)

Atlas Antibodies

Catalog No.:
ATL-HPA060469-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: CLK4-associating serine/arginine rich protein
Gene Name: CLASRP
Alternative Gene Name: CLASP, SFRS16, SWAP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061028: 100%, ENSRNOG00000046000: 100%
Entrez Gene ID: 11129
Uniprot ID: Q8N2M8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NSDEDEVIPDIDVEVDVDELNQEQVADLNKQATTYGMADGDFVRMLRKDKE
Gene Sequence NSDEDEVIPDIDVEVDVDELNQEQVADLNKQATTYGMADGDFVRMLRKDKE
Gene ID - Mouse ENSMUSG00000061028
Gene ID - Rat ENSRNOG00000046000
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CLASRP pAb (ATL-HPA060469)
Datasheet Anti CLASRP pAb (ATL-HPA060469) Datasheet (External Link)
Vendor Page Anti CLASRP pAb (ATL-HPA060469) at Atlas Antibodies

Documents & Links for Anti CLASRP pAb (ATL-HPA060469)
Datasheet Anti CLASRP pAb (ATL-HPA060469) Datasheet (External Link)
Vendor Page Anti CLASRP pAb (ATL-HPA060469)