Anti CLASRP pAb (ATL-HPA060469)
Atlas Antibodies
- Catalog No.:
- ATL-HPA060469-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: CLASRP
Alternative Gene Name: CLASP, SFRS16, SWAP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061028: 100%, ENSRNOG00000046000: 100%
Entrez Gene ID: 11129
Uniprot ID: Q8N2M8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NSDEDEVIPDIDVEVDVDELNQEQVADLNKQATTYGMADGDFVRMLRKDKE |
| Gene Sequence | NSDEDEVIPDIDVEVDVDELNQEQVADLNKQATTYGMADGDFVRMLRKDKE |
| Gene ID - Mouse | ENSMUSG00000061028 |
| Gene ID - Rat | ENSRNOG00000046000 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CLASRP pAb (ATL-HPA060469) | |
| Datasheet | Anti CLASRP pAb (ATL-HPA060469) Datasheet (External Link) |
| Vendor Page | Anti CLASRP pAb (ATL-HPA060469) at Atlas Antibodies |
| Documents & Links for Anti CLASRP pAb (ATL-HPA060469) | |
| Datasheet | Anti CLASRP pAb (ATL-HPA060469) Datasheet (External Link) |
| Vendor Page | Anti CLASRP pAb (ATL-HPA060469) |