Anti CLASRP pAb (ATL-HPA060469)

Atlas Antibodies

Catalog No.: ATL-HPA060469-25

Protein Description: CLK4-associating serine/arginine rich protein
Gene Name: CLASRP
Alternative Gene Name: CLASP, SFRS16, SWAP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061028: 100%, ENSRNOG00000046000: 100%
Entrez Gene ID: 11129
Uniprot ID: Q8N2M8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NSDEDEVIPDIDVEVDVDELNQEQVADLNKQATTYGMADGDFVRMLRKDKE
• Gene Sequence: NSDEDEVIPDIDVEVDVDELNQEQVADLNKQATTYGMADGDFVRMLRKDKE
• Gene ID - Mouse: ENSMUSG00000061028
• Gene ID - Rat: ENSRNOG00000046000
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.