Anti CKS2 pAb (ATL-HPA003424)

Atlas Antibodies

Catalog No.:
ATL-HPA003424-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: CDC28 protein kinase regulatory subunit 2
Gene Name: CKS2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062248: 99%, ENSRNOG00000014130: 99%
Entrez Gene ID: 1164
Uniprot ID: P33552
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQ
Gene Sequence HKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQ
Gene ID - Mouse ENSMUSG00000062248
Gene ID - Rat ENSRNOG00000014130
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CKS2 pAb (ATL-HPA003424)
Datasheet Anti CKS2 pAb (ATL-HPA003424) Datasheet (External Link)
Vendor Page Anti CKS2 pAb (ATL-HPA003424) at Atlas Antibodies

Documents & Links for Anti CKS2 pAb (ATL-HPA003424)
Datasheet Anti CKS2 pAb (ATL-HPA003424) Datasheet (External Link)
Vendor Page Anti CKS2 pAb (ATL-HPA003424)
Citations for Anti CKS2 pAb (ATL-HPA003424) – 1 Found
Hochane, Mazène; van den Berg, Patrick R; Fan, Xueying; Bérenger-Currias, Noémie; Adegeest, Esmée; Bialecka, Monika; Nieveen, Maaike; Menschaart, Maarten; Chuva de Sousa Lopes, Susana M; Semrau, Stefan. Single-cell transcriptomics reveals gene expression dynamics of human fetal kidney development. Plos Biology. 2019;17(2):e3000152.  PubMed