Anti CKS2 pAb (ATL-HPA003424)
Atlas Antibodies
- Catalog No.:
- ATL-HPA003424-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CKS2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062248: 99%, ENSRNOG00000014130: 99%
Entrez Gene ID: 1164
Uniprot ID: P33552
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | HKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQ |
Gene Sequence | HKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQ |
Gene ID - Mouse | ENSMUSG00000062248 |
Gene ID - Rat | ENSRNOG00000014130 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CKS2 pAb (ATL-HPA003424) | |
Datasheet | Anti CKS2 pAb (ATL-HPA003424) Datasheet (External Link) |
Vendor Page | Anti CKS2 pAb (ATL-HPA003424) at Atlas Antibodies |
Documents & Links for Anti CKS2 pAb (ATL-HPA003424) | |
Datasheet | Anti CKS2 pAb (ATL-HPA003424) Datasheet (External Link) |
Vendor Page | Anti CKS2 pAb (ATL-HPA003424) |
Citations for Anti CKS2 pAb (ATL-HPA003424) – 1 Found |
Hochane, Mazène; van den Berg, Patrick R; Fan, Xueying; Bérenger-Currias, Noémie; Adegeest, Esmée; Bialecka, Monika; Nieveen, Maaike; Menschaart, Maarten; Chuva de Sousa Lopes, Susana M; Semrau, Stefan. Single-cell transcriptomics reveals gene expression dynamics of human fetal kidney development. Plos Biology. 2019;17(2):e3000152. PubMed |