Anti CKMT2 pAb (ATL-HPA051880 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA051880-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: creatine kinase, mitochondrial 2 (sarcomeric)
Gene Name: CKMT2
Alternative Gene Name: SMTCK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021622: 84%, ENSRNOG00000055450: 79%
Entrez Gene ID: 1160
Uniprot ID: P17540
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ASIFSKLLTGRNASLLFATMGTSVLTTGYLLNRQKVCAEVREQPRLFPPSADYPDL
Gene Sequence ASIFSKLLTGRNASLLFATMGTSVLTTGYLLNRQKVCAEVREQPRLFPPSADYPDL
Gene ID - Mouse ENSMUSG00000021622
Gene ID - Rat ENSRNOG00000055450
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CKMT2 pAb (ATL-HPA051880 w/enhanced validation)
Datasheet Anti CKMT2 pAb (ATL-HPA051880 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CKMT2 pAb (ATL-HPA051880 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CKMT2 pAb (ATL-HPA051880 w/enhanced validation)
Datasheet Anti CKMT2 pAb (ATL-HPA051880 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CKMT2 pAb (ATL-HPA051880 w/enhanced validation)