Anti CKB pAb (ATL-HPA001254 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA001254-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: CKB
Alternative Gene Name: CKBB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001270: 99%, ENSRNOG00000010872: 98%
Entrez Gene ID: 1152
Uniprot ID: P12277
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK |
| Gene Sequence | VISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK |
| Gene ID - Mouse | ENSMUSG00000001270 |
| Gene ID - Rat | ENSRNOG00000010872 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CKB pAb (ATL-HPA001254 w/enhanced validation) | |
| Datasheet | Anti CKB pAb (ATL-HPA001254 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CKB pAb (ATL-HPA001254 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CKB pAb (ATL-HPA001254 w/enhanced validation) | |
| Datasheet | Anti CKB pAb (ATL-HPA001254 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CKB pAb (ATL-HPA001254 w/enhanced validation) |
| Citations for Anti CKB pAb (ATL-HPA001254 w/enhanced validation) – 5 Found |
| Kato, Bernet S; Nicholson, George; Neiman, Maja; Rantalainen, Mattias; Holmes, Chris C; Barrett, Amy; Uhlén, Mathias; Nilsson, Peter; Spector, Tim D; Schwenk, Jochen M. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Science. 2011;9( 22093360):73. PubMed |
| Bachmann, Julie; Burté, Florence; Pramana, Setia; Conte, Ianina; Brown, Biobele J; Orimadegun, Adebola E; Ajetunmobi, Wasiu A; Afolabi, Nathaniel K; Akinkunmi, Francis; Omokhodion, Samuel; Akinbami, Felix O; Shokunbi, Wuraola A; Kampf, Caroline; Pawitan, Yudi; Uhlén, Mathias; Sodeinde, Olugbemiro; Schwenk, Jochen M; Wahlgren, Mats; Fernandez-Reyes, Delmiro; Nilsson, Peter. Affinity proteomics reveals elevated muscle proteins in plasma of children with cerebral malaria. Plos Pathogens. 2014;10(4):e1004038. PubMed |
| Mello, Adriano Azevedo; Leal, Mariana Ferreira; Rey, Juan Antonio; Pinto, Giovanny Rebouças; Lamarão, Leticia Martins; Montenegro, Raquel Carvalho; Alves, Ana Paula Negreiros Nunes; Assumpção, Paulo Pimentel; Borges, Barbara do Nascimento; Smith, Marília Cardoso; Burbano, Rommel Rodriguez. Deregulated Expression of SRC, LYN and CKB Kinases by DNA Methylation and Its Potential Role in Gastric Cancer Invasiveness and Metastasis. Plos One. 10(10):e0140492. PubMed |
| Montenegro, Raquel Carvalho; Howarth, Alison; Ceroni, Alessandro; Fedele, Vita; Farran, Batoul; Mesquita, Felipe Pantoja; Frejno, Martin; Berger, Benedict-Tilman; Heinzlmeir, Stephanie; Sailem, Heba Z; Tesch, Roberta; Ebner, Daniel; Knapp, Stefan; Burbano, Rommel; Kuster, Bernhard; Müller, Susanne. Identification of molecular targets for the targeted treatment of gastric cancer using dasatinib. Oncotarget. 2020;11(5):535-549. PubMed |
| Signorelli, Mirko; Ayoglu, Burcu; Johansson, Camilla; Lochmüller, Hanns; Straub, Volker; Muntoni, Francesco; Niks, Erik; Tsonaka, Roula; Persson, Anja; Aartsma-Rus, Annemieke; Nilsson, Peter; Al-Khalili Szigyarto, Cristina; Spitali, Pietro. Longitudinal serum biomarker screening identifies malate dehydrogenase 2 as candidate prognostic biomarker for Duchenne muscular dystrophy. Journal Of Cachexia, Sarcopenia And Muscle. 2020;11(2):505-517. PubMed |