Anti CKAP5 pAb (ATL-HPA040375)
Atlas Antibodies
- Catalog No.:
- ATL-HPA040375-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CKAP5
Alternative Gene Name: ch-TOG, KIAA0097, TOG, TOGp
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040549: 99%, ENSRNOG00000016067: 100%
Entrez Gene ID: 9793
Uniprot ID: Q14008
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MSSKLNQARSMSGHPEAAQMVRREFQLDLDEIENDNGTVRCEMPELVQHKLDDIFEPVLIPEPKIRAVSPHFDDMHSNTASTINFI |
Gene Sequence | MSSKLNQARSMSGHPEAAQMVRREFQLDLDEIENDNGTVRCEMPELVQHKLDDIFEPVLIPEPKIRAVSPHFDDMHSNTASTINFI |
Gene ID - Mouse | ENSMUSG00000040549 |
Gene ID - Rat | ENSRNOG00000016067 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CKAP5 pAb (ATL-HPA040375) | |
Datasheet | Anti CKAP5 pAb (ATL-HPA040375) Datasheet (External Link) |
Vendor Page | Anti CKAP5 pAb (ATL-HPA040375) at Atlas Antibodies |
Documents & Links for Anti CKAP5 pAb (ATL-HPA040375) | |
Datasheet | Anti CKAP5 pAb (ATL-HPA040375) Datasheet (External Link) |
Vendor Page | Anti CKAP5 pAb (ATL-HPA040375) |
Citations for Anti CKAP5 pAb (ATL-HPA040375) – 1 Found |
Endo, Yukinori; Takeda, Kazuyo; Mohan, Nishant; Shen, Yi; Jiang, Jiangsong; Rotstein, David; Wu, Wen Jin. Payload of T-DM1 binds to cell surface cytoskeleton-associated protein 5 to mediate cytotoxicity of hepatocytes. Oncotarget. 2018;9(98):37200-37215. PubMed |