Anti CKAP5 pAb (ATL-HPA040375)

Atlas Antibodies

Catalog No.:
ATL-HPA040375-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: cytoskeleton associated protein 5
Gene Name: CKAP5
Alternative Gene Name: ch-TOG, KIAA0097, TOG, TOGp
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040549: 99%, ENSRNOG00000016067: 100%
Entrez Gene ID: 9793
Uniprot ID: Q14008
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSSKLNQARSMSGHPEAAQMVRREFQLDLDEIENDNGTVRCEMPELVQHKLDDIFEPVLIPEPKIRAVSPHFDDMHSNTASTINFI
Gene Sequence MSSKLNQARSMSGHPEAAQMVRREFQLDLDEIENDNGTVRCEMPELVQHKLDDIFEPVLIPEPKIRAVSPHFDDMHSNTASTINFI
Gene ID - Mouse ENSMUSG00000040549
Gene ID - Rat ENSRNOG00000016067
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CKAP5 pAb (ATL-HPA040375)
Datasheet Anti CKAP5 pAb (ATL-HPA040375) Datasheet (External Link)
Vendor Page Anti CKAP5 pAb (ATL-HPA040375) at Atlas Antibodies

Documents & Links for Anti CKAP5 pAb (ATL-HPA040375)
Datasheet Anti CKAP5 pAb (ATL-HPA040375) Datasheet (External Link)
Vendor Page Anti CKAP5 pAb (ATL-HPA040375)
Citations for Anti CKAP5 pAb (ATL-HPA040375) – 1 Found
Endo, Yukinori; Takeda, Kazuyo; Mohan, Nishant; Shen, Yi; Jiang, Jiangsong; Rotstein, David; Wu, Wen Jin. Payload of T-DM1 binds to cell surface cytoskeleton-associated protein 5 to mediate cytotoxicity of hepatocytes. Oncotarget. 2018;9(98):37200-37215.  PubMed