Anti CKAP4 pAb (ATL-HPA001225 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA001225-25
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nuclear speckles & cytosol.
  • Western blot analysis using Anti-CKAP4 antibody HPA001225 (A) shows similar pattern to independent antibody HPA000278 (B).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: cytoskeleton-associated protein 4
Gene Name: CKAP4
Alternative Gene Name: CLIMP-63, ERGIC-63, P63
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046841: 83%, ENSRNOG00000008016: 33%
Entrez Gene ID: 10970
Uniprot ID: Q07065
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LKDLSDGIHVVKDARERDFTSLENTVEERLTELTKSINDNIAIFTEVQKRSQKEINDMKAKVASLEESEGNKQDLKALKEAVKEIQTSAKSREWDMEALRSTLQTMES
Gene Sequence LKDLSDGIHVVKDARERDFTSLENTVEERLTELTKSINDNIAIFTEVQKRSQKEINDMKAKVASLEESEGNKQDLKALKEAVKEIQTSAKSREWDMEALRSTLQTMES
Gene ID - Mouse ENSMUSG00000046841
Gene ID - Rat ENSRNOG00000008016
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CKAP4 pAb (ATL-HPA001225 w/enhanced validation)
Datasheet Anti CKAP4 pAb (ATL-HPA001225 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CKAP4 pAb (ATL-HPA001225 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CKAP4 pAb (ATL-HPA001225 w/enhanced validation)
Datasheet Anti CKAP4 pAb (ATL-HPA001225 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CKAP4 pAb (ATL-HPA001225 w/enhanced validation)



Citations for Anti CKAP4 pAb (ATL-HPA001225 w/enhanced validation) – 1 Found
Opazo, Juan C; Vandewege, Michael W; Hoffmann, Federico G; Zavala, Kattina; Meléndez, Catalina; Luchsinger, Charlotte; Cavieres, Viviana A; Vargas-Chacoff, Luis; Morera, Francisco J; Burgos, Patricia V; Tapia-Rojas, Cheril; Mardones, Gonzalo A. How Many Sirtuin Genes Are Out There? Evolution of Sirtuin Genes in Vertebrates With a Description of a New Family Member. Molecular Biology And Evolution. 2023;40(2)  PubMed