Anti CKAP4 pAb (ATL-HPA000792 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA000792-25
  • Immunohistochemistry analysis in human cervix, uterine and skeletal muscle tissues using Anti-CKAP4 antibody. Corresponding CKAP4 RNA-seq data are presented for the same tissues.
  • Western blot analysis in human cell lines U-251MG and MCF-7 using Anti-CKAP4 antibody. Corresponding CKAP4 RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: cytoskeleton-associated protein 4
Gene Name: CKAP4
Alternative Gene Name: CLIMP-63, ERGIC-63, P63
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046841: 83%, ENSRNOG00000008016: 33%
Entrez Gene ID: 10970
Uniprot ID: Q07065
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen LKDLSDGIHVVKDARERDFTSLENTVEERLTELTKSINDNIAIFTEVQKRSQKEINDMKAKVASLEESEGNKQDLKALKEAVKEIQTSAKSREWDMEALRSTLQTMES
Gene Sequence LKDLSDGIHVVKDARERDFTSLENTVEERLTELTKSINDNIAIFTEVQKRSQKEINDMKAKVASLEESEGNKQDLKALKEAVKEIQTSAKSREWDMEALRSTLQTMES
Gene ID - Mouse ENSMUSG00000046841
Gene ID - Rat ENSRNOG00000008016
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CKAP4 pAb (ATL-HPA000792 w/enhanced validation)
Datasheet Anti CKAP4 pAb (ATL-HPA000792 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CKAP4 pAb (ATL-HPA000792 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CKAP4 pAb (ATL-HPA000792 w/enhanced validation)
Datasheet Anti CKAP4 pAb (ATL-HPA000792 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CKAP4 pAb (ATL-HPA000792 w/enhanced validation)