Anti CKAP2L pAb (ATL-HPA040057)

Atlas Antibodies

Catalog No.:
ATL-HPA040057-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: cytoskeleton associated protein 2-like
Gene Name: CKAP2L
Alternative Gene Name: FLJ40629
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048327: 51%, ENSRNOG00000026143: 53%
Entrez Gene ID: 150468
Uniprot ID: Q8IYA6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MNNIHVENESLDNFLKETNKENLLDILTEPERKPDPKLYTRSKPKTDSYNQTKNSLVPKQALGKSSVNSAVLKDRVNKQFVGETQSRTFPVKSQQLSRGADLARPGVKPSRTVPS
Gene Sequence MNNIHVENESLDNFLKETNKENLLDILTEPERKPDPKLYTRSKPKTDSYNQTKNSLVPKQALGKSSVNSAVLKDRVNKQFVGETQSRTFPVKSQQLSRGADLARPGVKPSRTVPS
Gene ID - Mouse ENSMUSG00000048327
Gene ID - Rat ENSRNOG00000026143
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CKAP2L pAb (ATL-HPA040057)
Datasheet Anti CKAP2L pAb (ATL-HPA040057) Datasheet (External Link)
Vendor Page Anti CKAP2L pAb (ATL-HPA040057) at Atlas Antibodies

Documents & Links for Anti CKAP2L pAb (ATL-HPA040057)
Datasheet Anti CKAP2L pAb (ATL-HPA040057) Datasheet (External Link)
Vendor Page Anti CKAP2L pAb (ATL-HPA040057)