Anti CKAP2 pAb (ATL-HPA008410 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA008410-25

• 
• 
• 

Protein Description: cytoskeleton associated protein 2
Gene Name: CKAP2
Alternative Gene Name: FLJ10749, LB1, se20-10, TMAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037725: 51%, ENSRNOG00000024650: 49%
Entrez Gene ID: 26586
Uniprot ID: Q8WWK9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PPIRSHHSNTRDTVKQGISRTSANVTIRKGPHEKELLQSKTALSSVKTSSSQGIIRNKTLSRSIASEVVARPASLSNDKLMEKSEPVDQRRHTAGKAIVDSRSAQPKETSEERKARLSEWKAGKGR
• Gene Sequence: PPIRSHHSNTRDTVKQGISRTSANVTIRKGPHEKELLQSKTALSSVKTSSSQGIIRNKTLSRSIASEVVARPASLSNDKLMEKSEPVDQRRHTAGKAIVDSRSAQPKETSEERKARLSEWKAGKGR
• Gene ID - Mouse: ENSMUSG00000037725
• Gene ID - Rat: ENSRNOG00000024650
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.