Anti CKAP2 pAb (ATL-HPA008410 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA008410-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CKAP2
Alternative Gene Name: FLJ10749, LB1, se20-10, TMAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037725: 51%, ENSRNOG00000024650: 49%
Entrez Gene ID: 26586
Uniprot ID: Q8WWK9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PPIRSHHSNTRDTVKQGISRTSANVTIRKGPHEKELLQSKTALSSVKTSSSQGIIRNKTLSRSIASEVVARPASLSNDKLMEKSEPVDQRRHTAGKAIVDSRSAQPKETSEERKARLSEWKAGKGR |
Gene Sequence | PPIRSHHSNTRDTVKQGISRTSANVTIRKGPHEKELLQSKTALSSVKTSSSQGIIRNKTLSRSIASEVVARPASLSNDKLMEKSEPVDQRRHTAGKAIVDSRSAQPKETSEERKARLSEWKAGKGR |
Gene ID - Mouse | ENSMUSG00000037725 |
Gene ID - Rat | ENSRNOG00000024650 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CKAP2 pAb (ATL-HPA008410 w/enhanced validation) | |
Datasheet | Anti CKAP2 pAb (ATL-HPA008410 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CKAP2 pAb (ATL-HPA008410 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti CKAP2 pAb (ATL-HPA008410 w/enhanced validation) | |
Datasheet | Anti CKAP2 pAb (ATL-HPA008410 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CKAP2 pAb (ATL-HPA008410 w/enhanced validation) |