Anti CIZ1 pAb (ATL-HPA020387)

Atlas Antibodies

Catalog No.:
ATL-HPA020387-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: CDKN1A interacting zinc finger protein 1
Gene Name: CIZ1
Alternative Gene Name: LSFR1, ZNF356
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039205: 48%, ENSRNOG00000013442: 53%
Entrez Gene ID: 25792
Uniprot ID: Q9ULV3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EQTPVVVHVCGLEMPPDAVEAGGGMEKTLPEPVGTQVSMEEIQNESACGLDVGECENRAREMPGVWGAGGSLKVTIL
Gene Sequence EQTPVVVHVCGLEMPPDAVEAGGGMEKTLPEPVGTQVSMEEIQNESACGLDVGECENRAREMPGVWGAGGSLKVTIL
Gene ID - Mouse ENSMUSG00000039205
Gene ID - Rat ENSRNOG00000013442
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CIZ1 pAb (ATL-HPA020387)
Datasheet Anti CIZ1 pAb (ATL-HPA020387) Datasheet (External Link)
Vendor Page Anti CIZ1 pAb (ATL-HPA020387) at Atlas Antibodies

Documents & Links for Anti CIZ1 pAb (ATL-HPA020387)
Datasheet Anti CIZ1 pAb (ATL-HPA020387) Datasheet (External Link)
Vendor Page Anti CIZ1 pAb (ATL-HPA020387)