Anti CIZ1 pAb (ATL-HPA020387)

Atlas Antibodies

SKU: ATL-HPA020387-25

• 
• 

Protein Description: CDKN1A interacting zinc finger protein 1
Gene Name: CIZ1
Alternative Gene Name: LSFR1, ZNF356
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039205: 48%, ENSRNOG00000013442: 53%
Entrez Gene ID: 25792
Uniprot ID: Q9ULV3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EQTPVVVHVCGLEMPPDAVEAGGGMEKTLPEPVGTQVSMEEIQNESACGLDVGECENRAREMPGVWGAGGSLKVTIL
• Gene Sequence: EQTPVVVHVCGLEMPPDAVEAGGGMEKTLPEPVGTQVSMEEIQNESACGLDVGECENRAREMPGVWGAGGSLKVTIL
• Gene ID - Mouse: ENSMUSG00000039205
• Gene ID - Rat: ENSRNOG00000013442
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.