Anti CIZ1 pAb (ATL-HPA020387)
Atlas Antibodies
- Catalog No.:
- ATL-HPA020387-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CIZ1
Alternative Gene Name: LSFR1, ZNF356
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039205: 48%, ENSRNOG00000013442: 53%
Entrez Gene ID: 25792
Uniprot ID: Q9ULV3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EQTPVVVHVCGLEMPPDAVEAGGGMEKTLPEPVGTQVSMEEIQNESACGLDVGECENRAREMPGVWGAGGSLKVTIL |
Gene Sequence | EQTPVVVHVCGLEMPPDAVEAGGGMEKTLPEPVGTQVSMEEIQNESACGLDVGECENRAREMPGVWGAGGSLKVTIL |
Gene ID - Mouse | ENSMUSG00000039205 |
Gene ID - Rat | ENSRNOG00000013442 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CIZ1 pAb (ATL-HPA020387) | |
Datasheet | Anti CIZ1 pAb (ATL-HPA020387) Datasheet (External Link) |
Vendor Page | Anti CIZ1 pAb (ATL-HPA020387) at Atlas Antibodies |
Documents & Links for Anti CIZ1 pAb (ATL-HPA020387) | |
Datasheet | Anti CIZ1 pAb (ATL-HPA020387) Datasheet (External Link) |
Vendor Page | Anti CIZ1 pAb (ATL-HPA020387) |