Anti CIT pAb (ATL-HPA075506)

Atlas Antibodies

Catalog No.:
ATL-HPA075506-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: citron rho-interacting serine/threonine kinase
Gene Name: CIT
Alternative Gene Name: CRIK, KIAA0949, STK21
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029516: 100%, ENSRNOG00000001143: 100%
Entrez Gene ID: 11113
Uniprot ID: O14578
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ERSDLEYQLENIQVLYSHEKVKMEGTISQQTKLIDFLQAKMDQPAKKKKGLFSRRKEDPALPTQVPLQYNELKLALEKEKARCA
Gene Sequence ERSDLEYQLENIQVLYSHEKVKMEGTISQQTKLIDFLQAKMDQPAKKKKGLFSRRKEDPALPTQVPLQYNELKLALEKEKARCA
Gene ID - Mouse ENSMUSG00000029516
Gene ID - Rat ENSRNOG00000001143
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CIT pAb (ATL-HPA075506)
Datasheet Anti CIT pAb (ATL-HPA075506) Datasheet (External Link)
Vendor Page Anti CIT pAb (ATL-HPA075506) at Atlas Antibodies

Documents & Links for Anti CIT pAb (ATL-HPA075506)
Datasheet Anti CIT pAb (ATL-HPA075506) Datasheet (External Link)
Vendor Page Anti CIT pAb (ATL-HPA075506)