Anti CISH pAb (ATL-HPA040812)

Atlas Antibodies

SKU: ATL-HPA040812-25

• 
• 

Protein Description: cytokine inducible SH2-containing protein
Gene Name: CISH
Alternative Gene Name: CIS, CIS-1, G18, SOCS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032578: 91%, ENSRNOG00000029543: 91%
Entrez Gene ID: 1154
Uniprot ID: Q9NSE2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: APSLELPKPVMQPLPAGAFLEEVAEGTPAQTESEPKVLDPEEDLLCIAKTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSVKTTRGPTNVRIEYADSSFRLDSNCLSR
• Gene Sequence: APSLELPKPVMQPLPAGAFLEEVAEGTPAQTESEPKVLDPEEDLLCIAKTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSVKTTRGPTNVRIEYADSSFRLDSNCLSR
• Gene ID - Mouse: ENSMUSG00000032578
• Gene ID - Rat: ENSRNOG00000029543
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.