Anti CISD2 pAb (ATL-HPA015914 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA015914-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: CISD2
Alternative Gene Name: ERIS, Miner1, NAF-1, WFS2, ZCD2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028165: 100%, ENSRNOG00000048258: 97%
Entrez Gene ID: 493856
Uniprot ID: Q8N5K1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PKKKQQKDSLINLKIQKENPKVVNEINIEDLCLTKAAYCRCWRSKTFPACDGSHNKHNELTGDNVGPLILKKKEV |
Gene Sequence | PKKKQQKDSLINLKIQKENPKVVNEINIEDLCLTKAAYCRCWRSKTFPACDGSHNKHNELTGDNVGPLILKKKEV |
Gene ID - Mouse | ENSMUSG00000028165 |
Gene ID - Rat | ENSRNOG00000048258 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CISD2 pAb (ATL-HPA015914 w/enhanced validation) | |
Datasheet | Anti CISD2 pAb (ATL-HPA015914 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CISD2 pAb (ATL-HPA015914 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti CISD2 pAb (ATL-HPA015914 w/enhanced validation) | |
Datasheet | Anti CISD2 pAb (ATL-HPA015914 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CISD2 pAb (ATL-HPA015914 w/enhanced validation) |
Citations for Anti CISD2 pAb (ATL-HPA015914 w/enhanced validation) – 3 Found |
Li, Shih-Miao; Chen, Chung-Hsing; Chen, Ya-Wen; Yen, Yi-Chen; Fang, Wen-Tsen; Tsai, Fang-Yu; Chang, Junn-Liang; Shen, Ying-Ying; Huang, Shiu-Feng; Chuu, Chih-Pin; Chang, I-Shou; Hsiung, Chao A; Jiang, Shih Sheng. Upregulation of CISD2 augments ROS homeostasis and contributes to tumorigenesis and poor prognosis of lung adenocarcinoma. Scientific Reports. 2017;7(1):11893. PubMed |
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. PubMed |
Darash-Yahana, Merav; Pozniak, Yair; Lu, Mingyang; Sohn, Yang-Sung; Karmi, Ola; Tamir, Sagi; Bai, Fang; Song, Luhua; Jennings, Patricia A; Pikarsky, Eli; Geiger, Tamar; Onuchic, José N; Mittler, Ron; Nechushtai, Rachel. Breast cancer tumorigenicity is dependent on high expression levels of NAF-1 and the lability of its Fe-S clusters. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2016;113(39):10890-5. PubMed |